# Anti-TTF1 Antibody \[ARC2744\]

**Cod produs:** A307806 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-TTF1 Antibody [ARC2744] este un anticorp monoclonal de iepure împotriva țintei TTF1, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TTF1 |
| Applications | IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2744 |
| Secvență | MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPY |
| Imunogen | Recombinant protein of human NKX2-1. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A307806-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2744] antibody to TTF1.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/307/A307806.pdf)

---

Sursă: https://reactivi.ro/produs/anti-ttf1-antibody-arc2744/ · actualizat 9 septembrie 2026