# Anti-Tryptophanyl tRNA synthetase/WRS Antibody \[ARC2687\]

**Cod produs:** A309093 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Tryptophanyl tRNA synthetase/WRS Antibody [ARC2687] este un anticorp monoclonal de iepure împotriva țintei Tryptophanyl tRNA synthetase/WRS, cu reactivitate declarată pentru Human. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Tryptophanyl tRNA synthetase/WRS |
| Applications | IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2687 |
| Secvență | VNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl-tRNA synthetase 1 (P23381). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A309093-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2687] antibody to Tryptophanyl tRNA synthetase/WRS.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/309/A309093.pdf)

---

Sursă: https://reactivi.ro/produs/anti-tryptophanyl-trna-synthetase-wrs-antibody-arc2687/ · actualizat 9 septembrie 2026
