# Anti-Trefoil Factor 3 Antibody \[ARC2664\]

**Cod produs:** A306815 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Trefoil Factor 3 Antibody [ARC2664] este un anticorp monoclonal de iepure împotriva țintei Trefoil Factor 3, cu reactivitate declarată pentru Human. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Trefoil Factor 3 |
| Applications | IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2664 |
| Secvență | MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-80 of human TFF3 (Q07654). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306815-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2664] antibody to Trefoil Factor 3.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306815.pdf)

---

Sursă: https://reactivi.ro/produs/anti-trefoil-factor-3-antibody-arc2664/ · actualizat 9 septembrie 2026