# Anti-TORC2 Antibody \[ARC2851\]

**Cod produs:** A308221 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-TORC2 Antibody [ARC2851] este un anticorp monoclonal de iepure împotriva țintei TORC2, cu reactivitate declarată pentru Human, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TORC2 |
| Applications | WB |
| Reactivity | Human, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 80 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2851 |
| Secvență | PQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 594-693 of human TORC2 (Q53ET0). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308221-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2851] antibody to TORC2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308221.pdf)

---

Sursă: https://reactivi.ro/produs/anti-torc2-antibody-arc2851/ · actualizat 9 septembrie 2026