# Anti-TMEM16A Antibody \[DOG-1.1\] - BSA and Azide free

**Cod produs:** A252876 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-TMEM16A Antibody [DOG-1.1] - BSA and Azide free este un anticorp monoclonal de șoarece împotriva țintei TMEM16A, cu reactivitate declarată pentru Human. Este validat pentru IHC-P, are izotipul IgG1 și se livrează neconjugat. Se livrează în mărimea 100µg, la prețul de 3.826,63 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TMEM16A |
| Applications | IHC-P |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in 10mM Phosphate Buffered Saline; without Sodium Azide and carrier free. |
| Host | Mouse |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Purification | Protein A/G chromatography. |
| Isotype | IgG1 |
| Recommended dilutions | IHC-P: 1-2 µg/ml |
| Molecular weight | 114 kDa |
| Light chain | kappa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | DOG-1.1 |
| Secvență | MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQL-LETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL |
| Imunogen | A synthetic peptide from human DOG-1 protein, conjugated to a carrier protein. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A252876-100 · 3.826,63 lei |

## Descriere

Mouse monoclonal [DOG-1.1] antibody to TMEM16A.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/252/A252876.pdf)

---

Sursă: https://reactivi.ro/produs/anti-tmem16a-antibody-dog-1-1-bsa-and-azide-free/ · actualizat 9 septembrie 2026
