# Anti-TLR4 Antibody

**Cod produs:** A283238 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-TLR4 Antibody este un anticorp policlonal de capră împotriva țintei TLR4, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC-P, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µg, la prețul de 3.826,63 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TLR4 |
| Applications | WB, IHC-P |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline with 0.1% BSA and 0.1% Sodium Azide. |
| Host | Goat |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Isotype | IgG |
| Recommended dilutions | IHC-P 1: 1:100 - 1:300, WB: 1:500 |
| Protein Length | 32 |
| Secvență | LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC |
| Imunogen | Synthetic peptide sequence LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminus of human CD284. |
| Aminoacizi | aa 161 - 192 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A283238-100 · 3.826,63 lei |

## Descriere

Goat polyclonal antibody to TLR4.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/283/A283238.pdf)

---

Sursă: https://reactivi.ro/produs/anti-tlr4-antibody-10/ · actualizat 9 septembrie 2026