# Anti-TIM 3 Antibody \[RMT3-23\]

**Cod produs:** A281690 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-TIM 3 Antibody [RMT3-23] este un anticorp monoclonal de șobolan împotriva țintei TIM 3, cu reactivitate declarată pentru Mouse. Este validat pentru IHC-P, IF, Flow Cytometry, IHC-Fr, are izotipul IgG2a și se livrează neconjugat. Se livrează în mărimea 100µg, la prețul de 2.429,08 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TIM 3 |
| Applications | IHC-P, IF, Flow Cytometry, IHC-Fr |
| Reactivity | Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide. |
| Host | Rat |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Purification | Protein G affinity chromatography of tissue culture supernatant. |
| Isotype | IgG2a |
| Recommended dilutions | Flow Cytometry: 1:25 - 1:200, Use 10µl of the suggested working dilution to label 106 cells in 100µl |
| Protein Length | 191 |
| Clonă | RMT3-23 |
| Secvență | MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR |
| Imunogen | Tim-3-Ig, consisting of amino acids 1-191 of mouse Tim-3, coupled with the Fc portion of mouse IgG2a. |
| Aminoacizi | aa 1 - 191 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A281690-100 · 2.429,08 lei |

## Descriere

Rat monoclonal [RMT3-23] antibody to TIM 3.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/281/A281690.pdf)

---

Sursă: https://reactivi.ro/produs/anti-tim-3-antibody-rmt3-23-2/ · actualizat 9 septembrie 2026