# Anti-Thromboxane synthase Antibody \[ARC1189\]

**Cod produs:** A307187 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Thromboxane synthase Antibody [ARC1189] este un anticorp monoclonal de iepure împotriva țintei Thromboxane synthase, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Thromboxane synthase |
| Applications | WB |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 60 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1189 |
| Secvență | MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVL |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thromboxane synthase (P24557). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A307187-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1189] antibody to Thromboxane synthase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/307/A307187.pdf)

---

Sursă: https://reactivi.ro/produs/anti-thromboxane-synthase-antibody-arc1189/ · actualizat 9 septembrie 2026
