# Anti-TGF beta Receptor I Antibody

**Cod produs:** A8453 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-TGF beta Receptor I Antibody este un anticorp policlonal de iepure împotriva țintei TGF beta Receptor I, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TGF beta Receptor I |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 56 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTGLPLLVQRTI |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 34-124 of human TGF beta Receptor I (TGF beta Receptor I (TGFBR1)) (NP_001124388.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A8453-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to TGF beta Receptor I.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/8/A8453.pdf)

---

Sursă: https://reactivi.ro/produs/anti-tgf-beta-receptor-i-antibody/ · actualizat 9 septembrie 2026