# Anti-Telomerase reverse transcriptase Antibody

**Cod produs:** A9120 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Telomerase reverse transcriptase Antibody este un anticorp policlonal de iepure împotriva țintei Telomerase Reverse Transcriptase, cu reactivitate declarată pentru Human, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Telomerase Reverse Transcriptase |
| Applications | WB |
| Reactivity | Human, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 127 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | NIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQ |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human TERT (NP_937983.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A9120-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Telomerase reverse transcriptase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/9/A9120.pdf)

---

Sursă: https://reactivi.ro/produs/anti-telomerase-reverse-transcriptase-antibody/ · actualizat 9 septembrie 2026
