# Anti-Telomerase reverse transcriptase Antibody \[ARC2711\]

**Cod produs:** A308052 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Telomerase reverse transcriptase Antibody [ARC2711] este un anticorp monoclonal de iepure împotriva țintei Telomerase Reverse Transcriptase, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Telomerase Reverse Transcriptase |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 126 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2711 |
| Secvență | NIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1000-1132 of human TERT (O14746). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308052-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2711] antibody to Telomerase reverse transcriptase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308052.pdf)

---

Sursă: https://reactivi.ro/produs/anti-telomerase-reverse-transcriptase-antibody-arc2711/ · actualizat 9 septembrie 2026