# Anti-TAS2R10 Antibody

**Cod produs:** A89505 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-TAS2R10 Antibody este un anticorp policlonal de iepure împotriva țintei TAS2R10, cu reactivitate declarată pentru Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | TAS2R10 |
| Applications | WB |
| Reactivity | Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 37 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | TSLSIFYFLKIANFSNYIFLWLKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISL |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TAS2R10 (NP_076410.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A89505-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to TAS2R10.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/89/A89505.pdf)

---

Sursă: https://reactivi.ro/produs/anti-tas2r10-antibody/ · actualizat 9 septembrie 2026
