# Anti-Surfactant Protein A/PSAP Antibody

**Cod produs:** A11614 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Surfactant Protein A/PSAP Antibody este un anticorp policlonal de iepure împotriva țintei Surfactant Protein A/PSAP, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Surfactant Protein A/PSAP |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, IHC: 1:50-1:200 |
| Molecular weight | 30 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | DAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 149-248 of human SFTPA1 (NP_005402.3). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A11614-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Surfactant Protein A/PSAP.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/11/A11614.pdf)

---

Sursă: https://reactivi.ro/produs/anti-surfactant-protein-a-psap-antibody/ · actualizat 9 septembrie 2026