# Anti-Somatostatin Receptor 5 Antibody \[ARC1282\]

**Cod produs:** A307261 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Somatostatin Receptor 5 Antibody [ARC1282] este un anticorp monoclonal de iepure împotriva țintei Somatostatin Receptor 5, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Somatostatin Receptor 5 |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:50-1:200 |
| Molecular weight | 45 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1282 |
| Secvență | MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQN |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SSTR5 (P35346). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A307261-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1282] antibody to Somatostatin Receptor 5.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/307/A307261.pdf)

---

Sursă: https://reactivi.ro/produs/anti-somatostatin-receptor-5-antibody-arc1282/ · actualizat 9 septembrie 2026