# Anti-Somatostatin Antibody \[ARC50670\]

**Cod produs:** A308885 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Somatostatin Antibody [ARC50670] este un anticorp monoclonal de iepure împotriva țintei Somatostatin, cu reactivitate declarată pentru Mouse, Rat. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Somatostatin |
| Applications | IHC |
| Reactivity | Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC50670 |
| Secvență | TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human Somatostatin (SST) (NP_001039.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308885-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC50670] antibody to Somatostatin.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308885.pdf)

---

Sursă: https://reactivi.ro/produs/anti-somatostatin-antibody-arc50670/ · actualizat 9 septembrie 2026