# Anti-smooth muscle Myosin heavy chain 11 Antibody \[ARC51911\]

**Cod produs:** A305652 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-smooth muscle Myosin heavy chain 11 Antibody [ARC51911] este un anticorp monoclonal de iepure împotriva țintei Smooth Muscle Myosin Heavy Chain 11, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, ICC/IF, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Smooth Muscle Myosin Heavy Chain 11 |
| Applications | WB, IHC, ICC/IF |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:2,000-1:9,000, ICC/IF: 1:50-1:200 |
| Molecular weight | 250 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC51911 |
| Secvență | DSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASL |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1313 of human SMMHC/MYH11 (NP_002465.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305652-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC51911] antibody to smooth muscle Myosin heavy chain 11.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305652.pdf)

---

Sursă: https://reactivi.ro/produs/anti-smooth-muscle-myosin-heavy-chain-11-antibody-arc51911/ · actualizat 9 septembrie 2026