# Anti-Smad3 Antibody \[ARC53861\]

**Cod produs:** A306181 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Smad3 Antibody [ARC53861] este un anticorp monoclonal de iepure împotriva țintei Smad3, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, ICC/IF, IP, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Smad3 |
| Applications | WB, IHC, ICC/IF, IP |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:100-1:500 |
| Molecular weight | 52 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC53861 |
| Secvență | HHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306181-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC53861] antibody to Smad3.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306181.pdf)

---

Sursă: https://reactivi.ro/produs/anti-smad3-antibody-arc53861/ · actualizat 9 septembrie 2026
