# Anti-SETD6 Antibody \[ARC55206\]

**Cod produs:** A308847 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-SETD6 Antibody [ARC55206] este un anticorp monoclonal de iepure împotriva țintei SETD6, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | SETD6 |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:5,000 |
| Molecular weight | 53 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC55206 |
| Secvență | TADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVGEEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLKTDQGLLSNKEVYAKLSWREQQALQVRYGQKMILHQLLELTS |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 310-473 of human SETD6 (NP_001153777.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308847-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC55206] antibody to SETD6.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308847.pdf)

---

Sursă: https://reactivi.ro/produs/anti-setd6-antibody-arc55206/ · actualizat 9 septembrie 2026
