# Anti-Serum Amyloid P/SAP Antibody

**Cod produs:** A13796 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Serum Amyloid P/SAP Antibody este un anticorp policlonal de iepure împotriva țintei Serum Amyloid P/SAP, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Serum Amyloid P/SAP |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, IHC: 1:50-1:100 |
| Molecular weight | 25 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | TSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPAN |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human APCS (NP_001630.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A13796-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Serum Amyloid P/SAP.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/13/A13796.pdf)

---

Sursă: https://reactivi.ro/produs/anti-serum-amyloid-p-sap-antibody/ · actualizat 9 septembrie 2026
