# Anti-Semaphorin 3A Antibody \[ARC56474\]

**Cod produs:** A305789 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Semaphorin 3A Antibody [ARC56474] este un anticorp monoclonal de iepure împotriva țintei Semaphorin 3A, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Semaphorin 3A |
| Applications | WB |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:2,000-1:20,000 |
| Molecular weight | 95 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC56474 |
| Secvență | ERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEERKEEIRVDDHIIRTDQGLLLRSLQQKDSGNYLCHAVEHGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRSV |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 582-771 of human Semaphorin 3A (NP_006071.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305789-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC56474] antibody to Semaphorin 3A.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305789.pdf)

---

Sursă: https://reactivi.ro/produs/anti-semaphorin-3a-antibody-arc56474/ · actualizat 9 septembrie 2026