# Anti-SCO2 Antibody

**Cod produs:** A15509 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-SCO2 Antibody este un anticorp policlonal de iepure împotriva țintei SCO2, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | SCO2 |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:50-1:200 |
| Molecular weight | 30 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | GQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-266 of human SCO2 (NP_005129.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A15509-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to SCO2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/15/A15509.pdf)

---

Sursă: https://reactivi.ro/produs/anti-sco2-antibody/ · actualizat 9 septembrie 2026
