# Anti-Puma gamma/GPR109A Antibody \[ARC54160\]

**Cod produs:** A305514 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Puma gamma/GPR109A Antibody [ARC54160] este un anticorp monoclonal de iepure împotriva țintei Puma gamma/GPR109A, cu reactivitate declarată pentru Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Puma gamma/GPR109A |
| Applications | WB |
| Reactivity | Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:5,000 |
| Molecular weight | 42 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC54160 |
| Secvență | CRLMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNRTAAIISCLLWGITIGLTVHLLKKKMPIQNGGANLCSSFSICHTFQWHEAMFLLEFFLP |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GPR109A/HM74A/HCAR2 (NP_808219.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305514-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC54160] antibody to Puma gamma/GPR109A.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305514.pdf)

---

Sursă: https://reactivi.ro/produs/anti-puma-gamma-gpr109a-antibody-arc54160/ · actualizat 9 septembrie 2026
