# Anti-PRSS23 Antibody

**Cod produs:** A92687 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-PRSS23 Antibody este un anticorp policlonal de iepure împotriva țintei PRSS23, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PRSS23 |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:100-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | QVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKSRRKRQIYGYDSRFSI |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human PRSS23 (NP_009104.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A92687-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to PRSS23.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/92/A92687.pdf)

---

Sursă: https://reactivi.ro/produs/anti-prss23-antibody/ · actualizat 9 septembrie 2026