# Anti-Prostaglandin F2 alpha Receptor/PTGFR Antibody

**Cod produs:** A89717 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Prostaglandin F2 alpha Receptor/PTGFR Antibody este un anticorp policlonal de iepure împotriva țintei Prostaglandin F2 alpha Receptor/PTGFR, cu reactivitate declarată pentru Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Prostaglandin F2 alpha Receptor/PTGFR |
| Applications | WB |
| Reactivity | Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 40 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | ILMKAYQRFRQKSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKPIFHSTKITSK |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PTGFR (NP_000950.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A89717-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Prostaglandin F2 alpha Receptor/PTGFR.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/89/A89717.pdf)

---

Sursă: https://reactivi.ro/produs/anti-prostaglandin-f2-alpha-receptor-ptgfr-antibody/ · actualizat 9 septembrie 2026