# Anti-Prostaglandin E Receptor EP1/PTGER1 Antibody

**Cod produs:** A89806 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Prostaglandin E Receptor EP1/PTGER1 Antibody este un anticorp policlonal de iepure împotriva țintei Prostaglandin E Receptor EP1/PTGER1, cu reactivitate declarată pentru Mouse. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Prostaglandin E Receptor EP1/PTGER1 |
| Applications | WB |
| Reactivity | Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 42 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | VGIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLS |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PGE receptor EP1 (PGE receptor EP1 (PTGER1)) (NP_000946.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A89806-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Prostaglandin E Receptor EP1/PTGER1.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/89/A89806.pdf)

---

Sursă: https://reactivi.ro/produs/anti-prostaglandin-e-receptor-ep1-ptger1-antibody-2/ · actualizat 9 septembrie 2026