# Anti-Prion Protein PrP Antibody \[ROS-BC6\]

**Cod produs:** A281701 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Prion Protein PrP Antibody [ROS-BC6] este un anticorp monoclonal de șoarece împotriva țintei Prion protein PrP, cu reactivitate declarată pentru Sheep, Bovine, Hamster, Mouse, Red deer. Este validat pentru WB, IHC-P, Flow Cytometry, are izotipul IgG1 și se livrează neconjugat. Se livrează în mărimea 100µg, la prețul de 2.595,45 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Prion protein PrP |
| Applications | WB, IHC-P, Flow Cytometry |
| Reactivity | Sheep, Bovine, Hamster, Mouse, Red deer |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide. |
| Host | Mouse |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Purification | Protein G affinity chromatography of tissue culture supernatant. |
| Isotype | IgG1 |
| Protein Length | 140 |
| Cross reactivity | This antibody does not cross-react with Human. |
| Clonă | ROS-BC6 |
| Secvență | GQGGSHSQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDRYSNQNNFVHDCVNITVKQHTVTTTTKGENFTETDIKIMERVVEQMCITQYQRESQAYYQRGA |
| Imunogen | A truncated form of recombinant sheep PRP spanning amino acids 94-233. |
| Aminoacizi | aa 94 - 233 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A281701-100 · 2.595,45 lei |

## Descriere

Mouse monoclonal [ROS-BC6] antibody to Prion Protein PrP.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/281/A281701.pdf)

---

Sursă: https://reactivi.ro/produs/anti-prion-protein-prp-antibody-ros-bc6/ · actualizat 9 septembrie 2026