# Anti-Poliovirus Receptor/PVR Antibody

**Cod produs:** A11872 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Poliovirus Receptor/PVR Antibody este un anticorp policlonal de iepure împotriva țintei Poliovirus Receptor/PVR, cu reactivitate declarată pentru Human, Mouse. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Poliovirus Receptor/PVR |
| Applications | WB |
| Reactivity | Human, Mouse |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:100-1:500 |
| Molecular weight | 70 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | HVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTS |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human CD155/PVR (NP_006496.4). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A11872-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Poliovirus Receptor/PVR.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/11/A11872.pdf)

---

Sursă: https://reactivi.ro/produs/anti-poliovirus-receptor-pvr-antibody/ · actualizat 9 septembrie 2026