# Anti-Placental lactogen Antibody \[ARC2426\]

**Cod produs:** A306956 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Placental lactogen Antibody [ARC2426] este un anticorp monoclonal de iepure împotriva țintei Placental Lactogen, cu reactivitate declarată pentru Human. Este validat pentru IHC, ICC/IF, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Placental Lactogen |
| Applications | IHC, ICC/IF |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200, ICC/IF: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC2426 |
| Secvență | MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLE |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Placental lactogen (CSH1) (CSH1) (P0DML2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306956-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC2426] antibody to Placental lactogen.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306956.pdf)

---

Sursă: https://reactivi.ro/produs/anti-placental-lactogen-antibody-arc2426/ · actualizat 9 septembrie 2026
