# Anti-PKC zeta Antibody \[ARC61755\]

**Cod produs:** A329751 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-PKC zeta Antibody [ARC61755] este un anticorp monoclonal de iepure împotriva țintei PKC zeta, cu reactivitate declarată pentru Human. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.861,65 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PKC zeta |
| Applications | WB, ELISA |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 0.05% BSA, 50% Glycerol, and 0.05% ProClin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 75 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC61755 |
| Secvență | MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTP |
| Imunogen | A recombinant fusion protein corresponding to amino acids 1-100 of human PKC zeta. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329751-100 · 2.861,65 lei |

## Descriere

Rabbit monoclonal [ARC61755] antibody to PKC zeta.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329751.pdf)

---

Sursă: https://reactivi.ro/produs/anti-pkc-zeta-antibody-arc61755/ · actualizat 9 septembrie 2026