# Anti-PKC gamma Antibody \[ARC1637\]

**Cod produs:** A305980 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-PKC gamma Antibody [ARC1637] este un anticorp monoclonal de iepure împotriva țintei PKC gamma, cu reactivitate declarată pentru Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PKC gamma |
| Applications | WB |
| Reactivity | Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 78 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1637 |
| Secvență | GEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 604-697 of human PKC gamma (P05129). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305980-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1637] antibody to PKC gamma.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305980.pdf)

---

Sursă: https://reactivi.ro/produs/anti-pkc-gamma-antibody-arc1637/ · actualizat 9 septembrie 2026