# Anti-PICK1 Antibody

**Cod produs:** A92776 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-PICK1 Antibody este un anticorp policlonal de iepure împotriva țintei PICK1, cu reactivitate declarată pentru Human. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PICK1 |
| Applications | IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | YLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 260-360 of human PICK1 (NP_036539.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A92776-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to PICK1.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/92/A92776.pdf)

---

Sursă: https://reactivi.ro/produs/anti-pick1-antibody-3/ · actualizat 9 septembrie 2026