# Anti-PI3K-gamma Antibody

**Cod produs:** A329743 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-PI3K-gamma Antibody este un anticorp policlonal de iepure împotriva țintei PI3K gamma, cu reactivitate declarată pentru Human. Este validat pentru IHC-P, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PI3K gamma |
| Applications | IHC-P, ELISA |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC-P: 1:50-1:200 |
| Molecular weight | ~ 126kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | WVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHVVLDTPPDPALDEVRKEEWPLVDDCT |
| Imunogen | A recombinant fusion protein corresponding to amino acids 201-330 of human PI3K-gamma. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329743-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to PI3K-gamma.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329743.pdf)

---

Sursă: https://reactivi.ro/produs/anti-pi3k-gamma-antibody/ · actualizat 9 septembrie 2026