# Anti-PI3 Kinase p110 beta Antibody \[ARC54484\]

**Cod produs:** A306499 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-PI3 Kinase p110 beta Antibody [ARC54484] este un anticorp monoclonal de iepure împotriva țintei PI3 Kinase p110 beta, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PI3 Kinase p110 beta |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:5,000, IHC: 1:100-1:500 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC54484 |
| Secvență | KVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRTGDIILHSWSSFPDELEEMLNPMGTVQTNPYTENATALHVKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 410-600 of human PI3 Kinase p110 beta (NP_006210.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306499-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC54484] antibody to PI3 Kinase p110 beta.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306499.pdf)

---

Sursă: https://reactivi.ro/produs/anti-pi3-kinase-p110-beta-antibody-arc54484/ · actualizat 9 septembrie 2026