# Anti-Phosphatidic acid phosphatase type 2B Antibody

**Cod produs:** A89590 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Phosphatidic acid phosphatase type 2B Antibody este un anticorp policlonal de iepure împotriva țintei Phosphatidic acid phosphatase type 2B, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Phosphatidic acid phosphatase type 2B |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000, IHC: 1:100-1:200 |
| Molecular weight | 35 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PPAP2B (NP_003704.3). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A89590-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Phosphatidic acid phosphatase type 2B.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/89/A89590.pdf)

---

Sursă: https://reactivi.ro/produs/anti-phosphatidic-acid-phosphatase-type-2b-antibody/ · actualizat 9 septembrie 2026