# Anti-PAX8 Antibody \[ARC55538\]

**Cod produs:** A305642 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-PAX8 Antibody [ARC55538] este un anticorp monoclonal de iepure împotriva țintei PAX8, cu reactivitate declarată pentru Human. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PAX8 |
| Applications | IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:100-1:500. |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC55538 |
| Secvență | DSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX8 (NP_003457.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A305642-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC55538] antibody to PAX8.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/305/A305642.pdf)

---

Sursă: https://reactivi.ro/produs/anti-pax8-antibody-arc55538/ · actualizat 9 septembrie 2026