# Anti-Parathyroid Hormone Receptor 1/PTH1R Antibody

**Cod produs:** A13629 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Parathyroid Hormone Receptor 1/PTH1R Antibody este un anticorp policlonal de iepure împotriva țintei Parathyroid Hormone Receptor 1/PTH1R, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Parathyroid Hormone Receptor 1/PTH1R |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:50-1:200 |
| Molecular weight | 66 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | GEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPALETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPERPPALLQEEWETVM |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 464-593 of human PTH1R (NP_000307.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A13629-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Parathyroid Hormone Receptor 1/PTH1R.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/13/A13629.pdf)

---

Sursă: https://reactivi.ro/produs/anti-parathyroid-hormone-receptor-1-pth1r-antibody/ · actualizat 9 septembrie 2026