# Anti-PACT (phospho KR activating protein)/PRKRA Antibody \[ARC1299\]

**Cod produs:** A309004 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-PACT (phospho KR activating protein)/PRKRA Antibody [ARC1299] este un anticorp monoclonal de iepure, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | PACT (phospho KR activating protein)/PRKRA |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IHC: 1:50-1:200 |
| Molecular weight | 34 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1299 |
| Secvență | TWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAHNALQYLKIIAERK |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 214-313 of human PRKRA/PACT (O75569). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A309004-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1299] antibody to PACT (PKR activating protein)/PRKRA.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/309/A309004.pdf)

---

Sursă: https://reactivi.ro/produs/anti-pact-phospho-kr-activating-protein-prkra-antibody-arc1299/ · actualizat 9 septembrie 2026