# Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody \[ARC0790\]

**Cod produs:** A308152 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody [ARC0790] este un anticorp monoclonal de iepure, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IP, ChIP, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | OGT/O-Linked N-Acetylglucosamine Transferase |
| Applications | WB, IP, ChIP |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000, IP: 1:500-1:1,000, ChIP: 1:500-1:1,000 |
| Molecular weight | 110 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC0790 |
| Secvență | PGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 947-1046 of human OGT (O15294). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308152-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC0790] antibody to OGT/O-Linked N-Acetylglucosamine Transferase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308152.pdf)

---

Sursă: https://reactivi.ro/produs/anti-ogt-o-linked-n-acetylglucosamine-transferase-antibody-arc0790/ · actualizat 9 septembrie 2026