# Anti-OGDH Antibody \[ARC55379\]

**Cod produs:** A308555 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-OGDH Antibody [ARC55379] este un anticorp monoclonal de iepure împotriva țintei OGDH, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | OGDH |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:5,000 |
| Molecular weight | 116 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC55379 |
| Secvență | RSSFDEMLPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTISRAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDVFKNFS |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 869-1023 of human OGDH (NP_002532.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308555-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC55379] antibody to OGDH.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308555.pdf)

---

Sursă: https://reactivi.ro/produs/anti-ogdh-antibody-arc55379/ · actualizat 9 septembrie 2026
