# Anti-NEDD4-2 Antibody \[ARC1404\]

**Cod produs:** A308045 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-NEDD4-2 Antibody [ARC1404] este un anticorp monoclonal de iepure împotriva țintei NEDD4-2, cu reactivitate declarată pentru Human. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | NEDD4-2 |
| Applications | WB |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 135 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC1404 |
| Secvență | NHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 876-975 of human NEDD4L (Q96PU5). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A308045-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC1404] antibody to NEDD4-2.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/308/A308045.pdf)

---

Sursă: https://reactivi.ro/produs/anti-nedd4-2-antibody-arc1404/ · actualizat 9 septembrie 2026