# Anti-Myelin Protein Zero Antibody \[ARC53696\]

**Cod produs:** A306501 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Myelin Protein Zero Antibody [ARC53696] este un anticorp monoclonal de iepure împotriva țintei Myelin Protein Zero, cu reactivitate declarată pentru Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Myelin Protein Zero |
| Applications | WB |
| Reactivity | Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:2,000-1:10,000 |
| Molecular weight | 28 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC53696 |
| Secvență | KVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 149-248 of human Myelin Protein Zero (MPZ) (NP_000521.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306501-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC53696] antibody to Myelin Protein Zero.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306501.pdf)

---

Sursă: https://reactivi.ro/produs/anti-myelin-protein-zero-antibody-arc53696/ · actualizat 9 septembrie 2026