# Anti-MRPL53 Antibody

**Cod produs:** A329638 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-MRPL53 Antibody este un anticorp policlonal de iepure împotriva țintei MRPL53, cu reactivitate declarată pentru Human. Este validat pentru WB, ELISA, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | MRPL53 |
| Applications | WB, ELISA |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:5,000 |
| Molecular weight | 12 kDa |
| Antigen species | Human |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR |
| Imunogen | A recombinant fusion protein corresponding to amino acids 1-112 of human MRPL53. |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A329638-100 · 3.094,58 lei |

## Descriere

Rabbit polyclonal antibody to MRPL53.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/329/A329638.pdf)

---

Sursă: https://reactivi.ro/produs/anti-mrpl53-antibody/ · actualizat 9 septembrie 2026
