# Anti-mH2A1 Antibody

**Cod produs:** A306291 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-mH2A1 Antibody este un anticorp policlonal de iepure împotriva țintei mH2A1, cu reactivitate declarată pentru Human. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | mH2A1 |
| Applications | WB |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | IHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human macroH2A.1 (NP_613258.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A306291-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to mH2A1.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/306/A306291.pdf)

---

Sursă: https://reactivi.ro/produs/anti-mh2a1-antibody-3/ · actualizat 9 septembrie 2026