# Anti-MFGE8 Antibody

**Cod produs:** A15039 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-MFGE8 Antibody este un anticorp policlonal de iepure împotriva țintei MFGE8, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | MFGE8 |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:2,000 |
| Molecular weight | 54kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPV |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human MFGE8 (NP_001108086.1). |
| Aminoacizi | 200 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A15039-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to MFGE8.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/15/A15039.pdf)

---

Sursă: https://reactivi.ro/produs/anti-mfge8-antibody/ · actualizat 9 septembrie 2026