# Anti-METTL4 Antibody

**Cod produs:** A16307 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-METTL4 Antibody este un anticorp policlonal de iepure împotriva țintei METTL4, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, ICC/IF, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | METTL4 |
| Applications | WB, IHC, ICC/IF |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:1,000-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200 |
| Molecular weight | 54 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPIT |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human METTL4 (NP_073751.3). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A16307-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to METTL4.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/16/A16307.pdf)

---

Sursă: https://reactivi.ro/produs/anti-mettl4-antibody/ · actualizat 9 septembrie 2026
