# Anti-Mast Cell Tryptase Antibody - Identical to Abcam (ab196772)

**Cod produs:** A13816 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Mast Cell Tryptase Antibody - Identical to Abcam (ab196772) este un anticorp policlonal de iepure împotriva țintei Mast Cell Tryptase, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Mast Cell Tryptase |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 30 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQ |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TPSAB1 (NP_003285.2). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A13816-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Mast Cell Tryptase.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/13/A13816.pdf)

---

Sursă: https://reactivi.ro/produs/anti-mast-cell-tryptase-antibody-identical-to-abcam-ab196772/ · actualizat 9 septembrie 2026