# Anti-Lysozyme Antibody \[ARC57153\]

**Cod produs:** A11385 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Lysozyme Antibody [ARC57153] este un anticorp monoclonal de iepure împotriva țintei Lysozyme, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 3.094,58 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Lysozyme |
| Applications | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300. |
| Host | Rabbit |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:2,000-1:20,000, IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Clonă | ARC57153 |
| Secvență | MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lysozyme (LYZ) (NP_000230.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A11385-100 · 3.094,58 lei |

## Descriere

Rabbit monoclonal [ARC57153] antibody to Lysozyme.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/11/A11385.pdf)

---

Sursă: https://reactivi.ro/produs/anti-lysozyme-antibody-arc57153/ · actualizat 9 septembrie 2026