# Anti-Leukotriene B4 Receptor/BLT Antibody

**Cod produs:** A89510 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Leukotriene B4 Receptor/BLT Antibody este un anticorp policlonal de iepure împotriva țintei Leukotriene B4 Receptor/BLT, cu reactivitate declarată pentru Mouse, Rat. Este validat pentru WB, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leukotriene B4 Receptor/BLT |
| Applications | WB |
| Reactivity | Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | WB: 1:500-1:1,000 |
| Molecular weight | 38 kDa |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN |
| Imunogen | A synthetic peptide corresponding to a sequence within amino acids 250-352 of human LTB4R (NP_001137391.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A89510-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Leukotriene B4 Receptor/BLT.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/89/A89510.pdf)

---

Sursă: https://reactivi.ro/produs/anti-leukotriene-b4-receptor-blt-antibody/ · actualizat 9 septembrie 2026