# Anti-Leptin Antibody

**Cod produs:** A9738 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-Leptin Antibody este un anticorp policlonal de iepure împotriva țintei Leptin, cu reactivitate declarată pentru Human. Este validat pentru IHC, are izotipul IgG și se livrează neconjugat. Se livrează în mărimea 100µl, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | Leptin |
| Applications | IHC |
| Reactivity | Human |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide. |
| Host | Rabbit |
| Clonality | Polyclonal |
| Product form | Liquid |
| Concentration | Lot Specific |
| Purification | Affinity purification. |
| Isotype | IgG |
| Recommended dilutions | IHC: 1:50-1:200 |
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Secvență | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Imunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-167 of human LEP (NP_000221.1). |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µl | A9738-100 · 2.662,00 lei |

## Descriere

Rabbit polyclonal antibody to Leptin.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/9/A9738.pdf)

---

Sursă: https://reactivi.ro/produs/anti-leptin-antibody/ · actualizat 9 septembrie 2026
