# Anti-LAMTOR4 Antibody \[EF01-1D8\]

**Cod produs:** A320301 · **Brand:** Antibodies · **Categorie:** Anticorpi primari

Anti-LAMTOR4 Antibody [EF01-1D8] este un anticorp monoclonal de șoarece împotriva țintei LAMTOR4, cu reactivitate declarată pentru Human, Mouse, Rat. Este validat pentru WB, are izotipul IgG2a și se livrează neconjugat. Se livrează în mărimea 100µg, la prețul de 2.662,00 lei cu TVA. Produse destinate exclusiv cercetării. Nu se utilizează în diagnostic sau tratament.

## Specificații

| Caracteristică | Valoare |
| --- | --- |
| Țintă biologică | LAMTOR4 |
| Applications | WB |
| Reactivity | Human, Mouse, Rat |
| Conjugate | Unconjugated |
| Formulation | Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide. |
| Host | Mouse |
| Clonality | Monoclonal |
| Product form | Liquid |
| Concentration | 1 mg/ml |
| Purification | Protein G affinity chromatography of tissue culture supernatant. |
| Isotype | IgG2a |
| Recommended dilutions | WB: 1:1,000 |
| Molecular weight | 12 kDa in LNCaP cell lysates |
| Protein Length | 99 |
| Clonă | EF01-1D8 |
| Secvență | MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV |
| Imunogen | E. coli derived recombinant protein corresponding to amino acids 1-99 of human LAMTOR4. |
| Aminoacizi | aa 1 - 99 |

## Mărimi și prețuri

| Mărime | Cod și preț (RON, TVA inclus) |
| --- | --- |
| 100µg | A320301-100 · 2.662,00 lei |

## Descriere

Mouse monoclonal [EF01-1D8] antibody to LAMTOR4.

## Documentație

- [Fișă tehnică (PDF)](https://www.antibodies.com/datasheets/320/A320301.pdf)

---

Sursă: https://reactivi.ro/produs/anti-lamtor4-antibody-ef01-1d8/ · actualizat 9 septembrie 2026